PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10008493m
Common NameCICLE_v10007882mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 407aa    MW: 44392.6 Da    PI: 6.8457
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10008493mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.74.2e-32217274260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  Ciclev10008493m 217 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 274
                      8****************************************.***************85 PP

2WRKY34.54.1e-11378399122
                      ---SS-EEEEEEE--TT-SS-E CS
             WRKY   1 ldDgynWrKYGqKevkgsefpr 22 
                      ldDgy+WrKYGqK+v+g+++pr
  Ciclev10008493m 378 LDDGYRWRKYGQKVVRGNPNPR 399
                      59*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182904.71E-25214275IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-27214275IPR003657WRKY domain
SMARTSM007744.1E-34216274IPR003657WRKY domain
PfamPF031061.0E-24217273IPR003657WRKY domain
PROSITE profilePS5081122.791217275IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.2E-13363399IPR003657WRKY domain
SuperFamilySSF1182902.75E-9370400IPR003657WRKY domain
PROSITE profilePS5081115.457373399IPR003657WRKY domain
SMARTSM007740.0017378406IPR003657WRKY domain
PfamPF031067.2E-7379400IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MEDTEVRVGD AADRTRGADV ASASGAGGGG ARYKLMSPAK LPISRSPCIM IPPGLSPSSF  60
LESPVLLSNV KAEPSPTTGS FFKPQAVHAS VGPRTYSTTT VCSNTLNEGE ASCFEFRPHS  120
RSNMVPADLN PQRSEQYVQT QGRCQTQSFA SSPTIKGEMT VSSNELSLLG PIQMATTGTI  180
VPAEVDSDEP KQMGQPSAGI QASHSDHKGG GPSMPSDDGY NWRKYGQKHV KGSEFPRSYY  240
KCTHPNCEVK KLFERSHDGQ ITEIIYKGTH DHPKPQLSRR YSAGNMMSIQ EERPDKVSSL  300
TCRDGSMYGQ MSHAMETNGT PDLSPVANDD SVEPDVDDDD QYSKRRKMDA LVADVTPVVK  360
PIREPRVVVQ TLSEVDILDD GYRWRKYGQK VVRGNPNPRY VSNLMI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A6e-172172751574WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006452514.10.0hypothetical protein CICLE_v10007882mg
SwissprotQ93WV01e-139WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLV4WGH50.0V4WGH5_9R
STRINGPOPTR_0001s37260.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-134WRKY family protein